Lineage for d3dutd_ (3dut D:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1253759Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1254600Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 1254718Species Human (Homo sapiens) [TaxId:9606] [46501] (207 PDB entries)
    Uniprot P68871
  8. 1254788Domain d3dutd_: 3dut D: [174249]
    Other proteins in same PDB: d3duta_, d3dutc_
    automated match to d1nqpb_
    complexed with hem, po4

Details for d3dutd_

PDB Entry: 3dut (more details), 1.55 Å

PDB Description: the high salt (phosphate) crystal structure of deoxy hemoglobin e (glu26lys) at physiological ph (ph 7.35)
PDB Compounds: (D:) Hemoglobin subunit beta

SCOPe Domain Sequences for d3dutd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dutd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
vhltpeeksavtalwgkvnvdevggkalgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d3dutd_:

Click to download the PDB-style file with coordinates for d3dutd_.
(The format of our PDB-style files is described here.)

Timeline for d3dutd_: