Lineage for d3du3m_ (3du3 M:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2255327Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2255328Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2255329Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2255419Protein M (medium) subunit [81481] (4 species)
  7. 2255420Species Rhodobacter sphaeroides [TaxId:1063] [81479] (60 PDB entries)
    Uniprot P02953
  8. 2255449Domain d3du3m_: 3du3 M: [174229]
    Other proteins in same PDB: d3du3h1, d3du3h2, d3du3l_
    automated match to d1ystm_
    complexed with bcl, bph, cdl, fe, lda, spn, u10; mutant

Details for d3du3m_

PDB Entry: 3du3 (more details), 2.8 Å

PDB Description: e(l212)a, d(l213)a, a(m249)y triple mutant structure of photosynthetic reaction center
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d3du3m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3du3m_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraylfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

SCOPe Domain Coordinates for d3du3m_:

Click to download the PDB-style file with coordinates for d3du3m_.
(The format of our PDB-style files is described here.)

Timeline for d3du3m_: