SCOPe 2.08: Domain d3dsza_: 3dsz A:

Lineage for d3dsza_ (3dsz A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein automated matches [190163] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188452] (14 PDB entries)

8. Domain d3dsza_: 3dsz A: [174216]
   automated match to d1ngla_
   complexed with liz, yt3

Details for d3dsza_

PDB Entry: 3dsz, 2 Å

PDB Description: Engineered human lipocalin 2 in complex with Y-DTPA

PDB Compounds: (A:) engineered human lipocalin 2

SCOPe Domain Sequences for d3dsza_:

Sequence; same for both SEQRES and ATOM records:

>d3dsza_ b.60.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lipapplskvplqqnfqdnqfhgkwyqvgragnaalredkdpqkmtaqiyelkedksynv
tavrfrkkkcdyltmtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffkkv
sqnreyfsitllgrtkelaselkenfirfskslglpenhivfpvpidqcidg

Timeline for d3dsza_:

• d3dsza_ first appeared in SCOPe 2.01
  
• d3dsza_ appears in SCOPe 2.07