SCOPe 2.06: Domain d3dqzd_: 3dqz D:

Lineage for d3dqzd_ (3dqz D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (91 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188958] (9 PDB entries)

8. Domain d3dqzd_: 3dqz D: [174198]
   automated match to d1xkla_
   complexed with cl

Details for d3dqzd_

PDB Entry: 3dqz, 2.5 Å

PDB Description: structure of the hydroxynitrile lyase from arabidopsis thaliana

PDB Compounds: (D:) Alpha-hydroxynitrile lyase-like protein

SCOPe Domain Sequences for d3dqzd_:

Sequence; same for both SEQRES and ATOM records:

>d3dqzd_ c.69.1.0 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rkhhfvlvhnayhgawiwyklkpllesaghrvtavelaasgidprpiqavetvdeyskpl
ietlkslpeneevilvgfsfgginialaadifpakikvlvflnaflpdtthvpshvldky
mempgglgdcefsshetrngtmsllkmgpkfmkarlyqncpiedyelakmlhrqgsffte
dlskkekfseegygsvqrvyvmssedkaipcdfirwmidnfnvskvyeidggdhmvmlsk
pqklfdslsaiatdy

Timeline for d3dqzd_:

• d3dqzd_ first appeared in SCOPe 2.01
  
• d3dqzd_ appears in SCOPe 2.05
  
• d3dqzd_ appears in SCOPe 2.07
  
• d3dqzd_ appears in the current release, SCOPe 2.08