![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily) core: 4 helices: bundle; unusual topology |
![]() | Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) ![]() duplication: consists of 2 helix-loop-helix structural repeats automatically mapped to Pfam PF02877 |
![]() | Family a.41.1.1: Domain of poly(ADP-ribose) polymerase [47588] (1 protein) |
![]() | Protein Domain of poly(ADP-ribose) polymerase [47589] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [47590] (7 PDB entries) |
![]() | Domain d3paxa1: 3pax A:662-796 [17415] Other proteins in same PDB: d3paxa2 complexed with 3mb |
PDB Entry: 3pax (more details), 2.4 Å
SCOPe Domain Sequences for d3paxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3paxa1 a.41.1.1 (A:662-796) Domain of poly(ADP-ribose) polymerase {Chicken (Gallus gallus) [TaxId: 9031]} ksklakpiqdlikmifdvesmkkamvefeidlqkmplgklskrqiqsaysilnevqqavs dggsesqildlsnrfytliphdfgmkkppllsnleyiqakvqmldnlldievaysllrgg nedgdkdpidinyek
Timeline for d3paxa1: