SCOPe 2.08: Domain d3dpbc_: 3dpb C:

Lineage for d3dpbc_ (3dpb C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (11 proteins)

6. Protein automated matches [190569] (9 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [188957] (3 PDB entries)

8. Domain d3dpbc_: 3dpb C: [174149]
   Other proteins in same PDB: d3dpba1, d3dpba2
   automated match to d1p5ub_
   mutant

Details for d3dpbc_

PDB Entry: 3dpb, 2.2 Å

PDB Description: crystal structure of the complex of the caf1m chaperone with the mini- fiber of two caf1 subunits (caf1:caf1), carrying the ala9val, ala11val, and leu13val mutations in the gd donor strand

PDB Compounds: (C:) F1 capsule antigen

SCOPe Domain Sequences for d3dpbc_:

Sequence, based on SEQRES records:

>d3dpbc_ b.2.3.2 (C:) automated matches {Yersinia pestis [TaxId: 632]}
itltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltftsqd
gnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdffvrsigskggklaagky
tdavtvtvsnq

Sequence, based on observed residues (ATOM records):

>d3dpbc_ b.2.3.2 (C:) automated matches {Yersinia pestis [TaxId: 632]}
itltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltftsqd
gnnhqfttkvigkdsrdfdispkvngenldvvlatgsqdffvrsigskggklaagkytda
vtvtvsnq

Timeline for d3dpbc_:

• d3dpbc_ first appeared in SCOPe 2.01
  
• d3dpbc_ appears in SCOPe 2.07