SCOPe 2.06: Domain d3dp5a1: 3dp5 A:26-104

Lineage for d3dp5a1 (3dp5 A:26-104)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (22 species)
   not a true protein

7. Species Geobacter sulfurreducens [TaxId:35554] [188580] (6 PDB entries)

8. Domain d3dp5a1: 3dp5 A:26-104 [174142]
   Other proteins in same PDB: d3dp5a2
   automated match to d1gdva_
   complexed with hem, so4

Details for d3dp5a1

PDB Entry: 3dp5, 1.86 Å

PDB Description: crystal structure of geobacter sulfurreducens omcf with n-terminal strep-tag ii

PDB Compounds: (A:) Cytochrome c family protein

SCOPe Domain Sequences for d3dp5a1:

Sequence; same for both SEQRES and ATOM records:

>d3dp5a1 a.3.1.0 (A:26-104) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
gggelfathcagchpqggntvhpektlararreangirtvrdvaayirnpgpgmpafgea
mippadalkigeyvvasfp

Timeline for d3dp5a1:

• d3dp5a1 first appeared in SCOPe 2.01, called d3dp5a_
  
• d3dp5a1 was called d3dp5a_ in SCOPe 2.05
  
• d3dp5a1 appears in SCOPe 2.07
  
• d3dp5a1 appears in the current release, SCOPe 2.08