SCOPe 2.05: Domain d3dp5a_: 3dp5 A:

Lineage for d3dp5a_ (3dp5 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (18 species)
   not a true protein

7. Species Geobacter sulfurreducens [TaxId:35554] [188580] (6 PDB entries)

8. Domain d3dp5a_: 3dp5 A: [174142]
   automated match to d1gdva_
   complexed with hem, so4

Details for d3dp5a_

PDB Entry: 3dp5, 1.86 Å

PDB Description: crystal structure of geobacter sulfurreducens omcf with n-terminal strep-tag ii

PDB Compounds: (A:) Cytochrome c family protein

SCOPe Domain Sequences for d3dp5a_:

Sequence; same for both SEQRES and ATOM records:

>d3dp5a_ a.3.1.0 (A:) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
aaswshpqfekgaetavpnsgggelfathcagchpqggntvhpektlararreangirtv
rdvaayirnpgpgmpafgeamippadalkigeyvvasfp

Timeline for d3dp5a_:

• d3dp5a_ first appeared in SCOPe 2.01
  
• d3dp5a_ appears in SCOPe 2.04
  
• d3dp5a_ is called d3dp5a1 in SCOPe 2.06
  
• d3dp5a_ appears in the current release, SCOPe 2.08, called d3dp5a1