![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
![]() | Protein automated matches [190453] (9 species) not a true protein |
![]() | Species Geobacter sulfurreducens [TaxId:35554] [188580] (2 PDB entries) |
![]() | Domain d3dp5a_: 3dp5 A: [174142] automated match to d1gdva_ complexed with hem, so4 |
PDB Entry: 3dp5 (more details), 1.86 Å
SCOPe Domain Sequences for d3dp5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dp5a_ a.3.1.0 (A:) automated matches {Geobacter sulfurreducens [TaxId: 35554]} aaswshpqfekgaetavpnsgggelfathcagchpqggntvhpektlararreangirtv rdvaayirnpgpgmpafgeamippadalkigeyvvasfp
Timeline for d3dp5a_: