Lineage for d3dp5a_ (3dp5 A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078002Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1078003Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1078555Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 1078556Protein automated matches [190453] (9 species)
    not a true protein
  7. 1078561Species Geobacter sulfurreducens [TaxId:35554] [188580] (2 PDB entries)
  8. 1078563Domain d3dp5a_: 3dp5 A: [174142]
    automated match to d1gdva_
    complexed with hem, so4

Details for d3dp5a_

PDB Entry: 3dp5 (more details), 1.86 Å

PDB Description: crystal structure of geobacter sulfurreducens omcf with n-terminal strep-tag ii
PDB Compounds: (A:) Cytochrome c family protein

SCOPe Domain Sequences for d3dp5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dp5a_ a.3.1.0 (A:) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
aaswshpqfekgaetavpnsgggelfathcagchpqggntvhpektlararreangirtv
rdvaayirnpgpgmpafgeamippadalkigeyvvasfp

SCOPe Domain Coordinates for d3dp5a_:

Click to download the PDB-style file with coordinates for d3dp5a_.
(The format of our PDB-style files is described here.)

Timeline for d3dp5a_: