Lineage for d3doua_ (3dou A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1175720Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1175721Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1176809Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1176810Protein automated matches [190689] (23 species)
    not a true protein
  7. 1176910Species Thermoplasma volcanium [TaxId:50339] [188579] (1 PDB entry)
  8. 1176911Domain d3doua_: 3dou A: [174103]
    automated match to d1eiza_
    complexed with sam

Details for d3doua_

PDB Entry: 3dou (more details), 1.45 Å

PDB Description: crystal structure of methyltransferase involved in cell division from thermoplasma volcanicum gss1
PDB Compounds: (A:) Ribosomal RNA large subunit methyltransferase J

SCOPe Domain Sequences for d3doua_:

Sequence, based on SEQRES records: (download)

>d3doua_ c.66.1.0 (A:) automated matches {Thermoplasma volcanium [TaxId: 50339]}
qlrsraafkleflldryrvvrkgdavieigsspggwtqvlnslarkiisidlqemeeiag
vrfircdifketifddidralreegiekvddvvsdamakvsgipsrdhavsyqigqrvme
iavrylrnggnvllkqfqgdmtndfiaiwrknfssykiskppasrgssseiyimffgfka
e

Sequence, based on observed residues (ATOM records): (download)

>d3doua_ c.66.1.0 (A:) automated matches {Thermoplasma volcanium [TaxId: 50339]}
qlrsraafkleflldryrvvrkgdavieigsspggwtqvlnslarkiisidlqemeeiag
vrfircdifketifddidralreegiekvddvvsdamakvsgipsrdhavsyqigqrvme
iavrylrnggnvllkqfqgdmtndfiaiwrknfssykiskpsseiyimffgfkae

SCOPe Domain Coordinates for d3doua_:

Click to download the PDB-style file with coordinates for d3doua_.
(The format of our PDB-style files is described here.)

Timeline for d3doua_: