Lineage for d3doea_ (3doe A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1595370Protein automated matches [190047] (24 species)
    not a true protein
  7. 1595427Species Human (Homo sapiens) [TaxId:9606] [186768] (124 PDB entries)
  8. 1595591Domain d3doea_: 3doe A: [174096]
    automated match to d1ksga_
    complexed with gtp, mg

Details for d3doea_

PDB Entry: 3doe (more details), 2.25 Å

PDB Description: Complex of ARL2 and BART, Crystal Form 1
PDB Compounds: (A:) ADP-ribosylation factor-like protein 2

SCOPe Domain Sequences for d3doea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3doea_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glltilkkmkqkerelrllmlgldnagkttilkkfngedidtisptlgfniktlehrgfk
lniwdvggqkslrsywrnyfestdgliwvvdsadrqrmqdcqrelqsllveerlagatll
ifankqdlpgalssnairevleldsirshhwciqgcsavtgenllpgidwllddissrif
tadlehhhh

SCOPe Domain Coordinates for d3doea_:

Click to download the PDB-style file with coordinates for d3doea_.
(The format of our PDB-style files is described here.)

Timeline for d3doea_: