Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (58 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [188476] (7 PDB entries) |
Domain d3do6b_: 3do6 B: [174093] automated match to d1fp7a_ complexed with edo |
PDB Entry: 3do6 (more details), 1.85 Å
SCOPe Domain Sequences for d3do6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3do6b_ c.37.1.0 (B:) automated matches {Thermotoga maritima [TaxId: 2336]} gmkpikeiadqlelkddilypyghyiakidhrflkslenhedgklilvtavtptpagegk tttsiglsmslnrigkksivtlrepslgptlglkggatgggrsrvlpsdeinlhftgdmh avasahnllaavldshikhgnelkiditrvfwkrtmdmndralrsiviglggsangfpre dsfiitaasevmailalsenmkdlkerlgkiivaldadrkivrisdlgiqgamavllkda inpnlvqttegtpalihcgpfaniahgtnsiiatkmamklseytvteagfgadlgaekfi dfvsrvggfypnaavlvatvralkyhgganlkniheenlealkegfknlrvhvenlrkfn lpvvvalnrfstdtekeiayvvkeceklgvrvavsevfkkgseggvelakavaeaakdve paylyemndpvekkieilakeiyragrvefsdtaknalkfikkhgfdelpvivaktpksi shdpslrgapegytfvvsdlfvsagagfvvalsgdinlmpglpkkpnalnmdvddsgniv gvs
Timeline for d3do6b_: