Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
Protein automated matches [190074] (15 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:28450] [188498] (1 PDB entry) |
Domain d3dmpa1: 3dmp A:1-213 [174059] Other proteins in same PDB: d3dmpa2, d3dmpb2, d3dmpc2, d3dmpd2 automated match to d1i5ea_ |
PDB Entry: 3dmp (more details), 2.6 Å
SCOPe Domain Sequences for d3dmpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dmpa1 c.61.1.1 (A:1-213) automated matches {Burkholderia pseudomallei [TaxId: 28450]} mkqdsrfpnlfildhpliqhklthmrdkdtstrtfrellreitllmgyeitrnlpittkr vetplveidapviagkklaivpvlragvgmsdgllelipsarvghigvyraddhrpveyl vrlpdledrifilcdpmvatgysaahaidvlkrrgvpgerlmflalvaapegvqvfqdah pdvklyvasldshlddhayivpglgdagdrlfg
Timeline for d3dmpa1: