Lineage for d3dkca_ (3dkc A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1434799Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species)
    PTK group; HGFR subfamily; membrane spanning protein tyrosine kinase
  7. 1434800Species Human (Homo sapiens) [TaxId:9606] [103301] (34 PDB entries)
  8. 1434803Domain d3dkca_: 3dkc A: [174029]
    automated match to d1r0pa_
    complexed with atp, cl, mg

Details for d3dkca_

PDB Entry: 3dkc (more details), 1.52 Å

PDB Description: structure of met receptor tyrosine kinase in complex with atp
PDB Compounds: (A:) Met proto-oncogene

SCOPe Domain Sequences for d3dkca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dkca_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
vhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavk
slnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfir
nethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglardmy
dkefdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntf
ditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyv
hvnatyvnvkeg

SCOPe Domain Coordinates for d3dkca_:

Click to download the PDB-style file with coordinates for d3dkca_.
(The format of our PDB-style files is described here.)

Timeline for d3dkca_: