Lineage for d3dhra_ (3dhr A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903555Protein automated matches [190359] (30 species)
    not a true protein
  7. 903664Species Domestic pigeon (Columba livia) [TaxId:8932] [188616] (2 PDB entries)
  8. 903669Domain d3dhra_: 3dhr A: [173959]
    automated match to d1fawa_
    complexed with hem

Details for d3dhra_

PDB Entry: 3dhr (more details), 2 Å

PDB Description: crystal structure determination of methemoglobin from pigeon at 2 angstrom resolution (columba livia)
PDB Compounds: (A:) Hemoglobin subunit alpha-A

SCOPe Domain Sequences for d3dhra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dhra_ a.1.1.2 (A:) automated matches {Domestic pigeon (Columba livia) [TaxId: 8932]}
vlsandksnvkavfakiggqagdlggealerlfitypqtktyfphfdlshgsaqikghgk
kvaealveaanhiddiagalsklsdlhaqklrvdpvnfkllghcflvvvavhfpslltpe
vhasldkfvlavgtvltakyr

SCOPe Domain Coordinates for d3dhra_:

Click to download the PDB-style file with coordinates for d3dhra_.
(The format of our PDB-style files is described here.)

Timeline for d3dhra_: