Lineage for d3dhie_ (3dhi E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2584614Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
    corner-like structure formed by two sheets and filled in with 2-3 helices
  4. 2584615Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) (S)
    duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold
  5. 2584616Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins)
    note: the solution structure determinations disagree in the relative orientations of two motifs
  6. 2584630Protein Toluene-4-monooxygenase catalytic effector protein [64394] (1 species)
  7. 2584631Species Pseudomonas mendocina [TaxId:300] [64395] (18 PDB entries)
  8. 2584638Domain d3dhie_: 3dhi E: [173949]
    Other proteins in same PDB: d3dhia_, d3dhic_
    automated match to d1g10a_
    complexed with 1pe, act, btb, fe

Details for d3dhie_

PDB Entry: 3dhi (more details), 1.68 Å

PDB Description: crystal structure of reduced toluene 4-monoxygenase hydroxylase complexed with effector protein
PDB Compounds: (E:) Toluene-4-monooxygenase system effector protein

SCOPe Domain Sequences for d3dhie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dhie_ d.137.1.1 (E:) Toluene-4-monooxygenase catalytic effector protein {Pseudomonas mendocina [TaxId: 300]}
mstladqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegelilt
rktleeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm

SCOPe Domain Coordinates for d3dhie_:

Click to download the PDB-style file with coordinates for d3dhie_.
(The format of our PDB-style files is described here.)

Timeline for d3dhie_: