Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily) corner-like structure formed by two sheets and filled in with 2-3 helices |
Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold |
Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins) note: the solution structure determinations disagree in the relative orientations of two motifs |
Protein Toluene-4-monooxygenase catalytic effector protein [64394] (1 species) |
Species Pseudomonas mendocina [TaxId:300] [64395] (18 PDB entries) |
Domain d3dhie_: 3dhi E: [173949] Other proteins in same PDB: d3dhia_, d3dhic_ automated match to d1g10a_ complexed with 1pe, act, btb, fe |
PDB Entry: 3dhi (more details), 1.68 Å
SCOPe Domain Sequences for d3dhie_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dhie_ d.137.1.1 (E:) Toluene-4-monooxygenase catalytic effector protein {Pseudomonas mendocina [TaxId: 300]} mstladqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegelilt rktleeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm
Timeline for d3dhie_: