Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.12: TmoB-like [110814] (2 families) possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies |
Family d.15.12.0: automated matches [191572] (1 protein) not a true family |
Protein automated matches [190991] (1 species) not a true protein |
Species Pseudomonas mendocina [TaxId:300] [188696] (20 PDB entries) |
Domain d3dhgc_: 3dhg C: [173941] Other proteins in same PDB: d3dhga_, d3dhgd_ automated match to d1t0rc_ complexed with azi, ca, fe |
PDB Entry: 3dhg (more details), 1.85 Å
SCOPe Domain Sequences for d3dhgc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dhgc_ d.15.12.0 (C:) automated matches {Pseudomonas mendocina [TaxId: 300]} safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf prdmtiaesglnptevidvvfe
Timeline for d3dhgc_: