Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (71 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [188956] (11 PDB entries) |
Domain d3dged_: 3dge D: [173925] Other proteins in same PDB: d3dgea1, d3dgeb1, d3dgeb2 automated match to d1mvoa_ complexed with adp, cit, so4 |
PDB Entry: 3dge (more details), 2.8 Å
SCOPe Domain Sequences for d3dged_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dged_ c.23.1.0 (D:) automated matches {Thermotoga maritima [TaxId: 2336]} mskkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmd gftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhll ne
Timeline for d3dged_:
View in 3D Domains from other chains: (mouse over for more information) d3dgea1, d3dgeb1, d3dgeb2, d3dgec_ |