Lineage for d3dged_ (3dge D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1837703Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1838070Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1838071Protein automated matches [190131] (59 species)
    not a true protein
  7. 1838288Species Thermotoga maritima [TaxId:2336] [188956] (11 PDB entries)
  8. 1838308Domain d3dged_: 3dge D: [173925]
    Other proteins in same PDB: d3dgea1, d3dgeb1, d3dgeb2
    automated match to d1mvoa_
    complexed with adp, cit, so4

Details for d3dged_

PDB Entry: 3dge (more details), 2.8 Å

PDB Description: Structure of a histidine kinase-response regulator complex reveals insights into Two-component signaling and a novel cis-autophosphorylation mechanism
PDB Compounds: (D:) Response regulator

SCOPe Domain Sequences for d3dged_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dged_ c.23.1.0 (D:) automated matches {Thermotoga maritima [TaxId: 2336]}
mskkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmd
gftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhll
ne

SCOPe Domain Coordinates for d3dged_:

Click to download the PDB-style file with coordinates for d3dged_.
(The format of our PDB-style files is described here.)

Timeline for d3dged_: