SCOPe 2.08: Domain d3dfee_: 3dfe E:

Lineage for d3dfee_ (3dfe E:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.0: automated matches [191474] (1 protein)
   not a true family

6. Protein automated matches [190753] (21 species)
   not a true protein

7. Species Anabaena variabilis [TaxId:240292] [188517] (1 PDB entry)

8. Domain d3dfee_: 3dfe E: [173890]
   automated match to d2cz4a1
   complexed with edo, ipa

Details for d3dfee_

PDB Entry: 3dfe, 2.35 Å

PDB Description: crystal structure of a putative pii-like signaling protein (yp_323533.1) from anabaena variabilis atcc 29413 at 2.35 a resolution

PDB Compounds: (E:) Putative Pii-Like Signaling Protein

SCOPe Domain Sequences for d3dfee_:

Sequence, based on SEQRES records:

>d3dfee_ d.58.5.0 (E:) automated matches {Anabaena variabilis [TaxId: 240292]}
skranklvivtekvllkkvakiieeagatgytvvdtggkgsrnvrstgkpntsdtdsnvk
fevltenremaekiadqvaikfftdyagiiyiceaevlyg

Sequence, based on observed residues (ATOM records):

>d3dfee_ d.58.5.0 (E:) automated matches {Anabaena variabilis [TaxId: 240292]}
skranklvivtekvllkkvakiieeagatgytvvdtggnvkfevltenremaekiadqva
ikfftdyagiiyiceaevlyg

Timeline for d3dfee_:

• d3dfee_ first appeared in SCOPe 2.01
  
• d3dfee_ appears in SCOPe 2.07