SCOP 1.65: Domain d1dqeb_: 1dqe B:

Lineage for d1dqeb_ (1dqe B:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromon/odorant-binding proteins [47565] (1 family)
   the N-terminal extention, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromon/odorant-binding proteins [47566] (2 proteins)

6. Protein Pheromone binding protein [47569] (1 species)

7. Species Silkworm (Bombyx mori) [TaxId:7091] [47570] (3 PDB entries)

8. Domain d1dqeb_: 1dqe B: [17389]
   complexed with bom

Details for d1dqeb_

PDB Entry: 1dqe, 1.8 Å

PDB Description: bombyx mori pheromone binding protein

SCOP Domain Sequences for d1dqeb_:

Sequence; same for both SEQRES and ATOM records:

>d1dqeb_ a.39.2.1 (B:) Pheromone binding protein {Silkworm (Bombyx mori)}
sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
eihklnwapsmdvavge

Timeline for d1dqeb_:

• d1dqeb_ first appeared (with stable ids) in SCOP 1.55
  
• d1dqeb_ appears in SCOP 1.63
  
• d1dqeb_ appears in SCOP 1.67
  
• d1dqeb_ appears in the current release, SCOPe 2.08