Lineage for d1dqea_ (1dqe A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 280804Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 281310Superfamily a.39.2: Insect pheromon/odorant-binding proteins [47565] (1 family) (S)
    the N-terminal extention, containing a few short helices, forms a flexible lid for the binding cavity
  5. 281311Family a.39.2.1: Insect pheromon/odorant-binding proteins [47566] (2 proteins)
  6. 281312Protein Pheromone binding protein [47569] (1 species)
  7. 281313Species Silkworm (Bombyx mori) [TaxId:7091] [47570] (3 PDB entries)
  8. 281314Domain d1dqea_: 1dqe A: [17388]

Details for d1dqea_

PDB Entry: 1dqe (more details), 1.8 Å

PDB Description: bombyx mori pheromone binding protein

SCOP Domain Sequences for d1dqea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqea_ a.39.2.1 (A:) Pheromone binding protein {Silkworm (Bombyx mori)}
sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
eihklnwapsmdvavge

SCOP Domain Coordinates for d1dqea_:

Click to download the PDB-style file with coordinates for d1dqea_.
(The format of our PDB-style files is described here.)

Timeline for d1dqea_: