Lineage for d1c3ya_ (1c3y A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2325006Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 2325007Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
    automatically mapped to Pfam PF01395
  6. 2325074Protein Thp12-carrier protein [47567] (1 species)
  7. 2325075Species Yellow mealworm (Tenebrio molitor) [TaxId:7067] [47568] (2 PDB entries)
  8. 2325077Domain d1c3ya_: 1c3y A: [17387]

Details for d1c3ya_

PDB Entry: 1c3y (more details)

PDB Description: thp12-carrier protein from yellow meal worm
PDB Compounds: (A:) thp12 carrier protein

SCOPe Domain Sequences for d1c3ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3ya_ a.39.2.1 (A:) Thp12-carrier protein {Yellow mealworm (Tenebrio molitor) [TaxId: 7067]}
etpreklkqhsdackaesgvseeslnkvrnreevddpklkehafcilkragfidasgefq
ldhiktkfkensehpekvddlvakcavkkdtpqhssadffkcvhdnrs

SCOPe Domain Coordinates for d1c3ya_:

Click to download the PDB-style file with coordinates for d1c3ya_.
(The format of our PDB-style files is described here.)

Timeline for d1c3ya_: