Lineage for d1c3ya_ (1c3y A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640657Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 641396Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (1 family) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 641397Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (5 proteins)
  6. 641435Protein Thp12-carrier protein [47567] (1 species)
  7. 641436Species Yellow mealworm (Tenebrio molitor) [TaxId:7067] [47568] (2 PDB entries)
  8. 641437Domain d1c3ya_: 1c3y A: [17387]

Details for d1c3ya_

PDB Entry: 1c3y (more details)

PDB Description: thp12-carrier protein from yellow meal worm
PDB Compounds: (A:) thp12 carrier protein

SCOP Domain Sequences for d1c3ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3ya_ a.39.2.1 (A:) Thp12-carrier protein {Yellow mealworm (Tenebrio molitor) [TaxId: 7067]}
etpreklkqhsdackaesgvseeslnkvrnreevddpklkehafcilkragfidasgefq
ldhiktkfkensehpekvddlvakcavkkdtpqhssadffkcvhdnrs

SCOP Domain Coordinates for d1c3ya_:

Click to download the PDB-style file with coordinates for d1c3ya_.
(The format of our PDB-style files is described here.)

Timeline for d1c3ya_: