Lineage for d1c3ya_ (1c3y A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 152429Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 152864Superfamily a.39.2: Insect pheromon/odorant-binding proteins [47565] (1 family) (S)
  5. 152865Family a.39.2.1: Insect pheromon/odorant-binding proteins [47566] (2 proteins)
  6. 152871Protein Thp12-carrier protein [47567] (1 species)
  7. 152872Species Yellow mealworm (Tenebrio molitor) [TaxId:7067] [47568] (2 PDB entries)
  8. 152874Domain d1c3ya_: 1c3y A: [17387]

Details for d1c3ya_

PDB Entry: 1c3y (more details)

PDB Description: thp12-carrier protein from yellow meal worm

SCOP Domain Sequences for d1c3ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3ya_ a.39.2.1 (A:) Thp12-carrier protein {Yellow mealworm (Tenebrio molitor)}
etpreklkqhsdackaesgvseeslnkvrnreevddpklkehafcilkragfidasgefq
ldhiktkfkensehpekvddlvakcavkkdtpqhssadffkcvhdnrs

SCOP Domain Coordinates for d1c3ya_:

Click to download the PDB-style file with coordinates for d1c3ya_.
(The format of our PDB-style files is described here.)

Timeline for d1c3ya_: