SCOPe 2.06: Domain d1c3za_: 1c3z A:

Lineage for d1c3za_ (1c3z A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
   automatically mapped to Pfam PF01395

6. Protein Thp12-carrier protein [47567] (1 species)

7. Species Yellow mealworm (Tenebrio molitor) [TaxId:7067] [47568] (2 PDB entries)

8. Domain d1c3za_: 1c3z A: [17386]

Details for d1c3za_

PDB Entry: 1c3z

PDB Description: thp12-carrier protein from yellow meal worm

PDB Compounds: (A:) thp12 carrier protein

SCOPe Domain Sequences for d1c3za_:

Sequence; same for both SEQRES and ATOM records:

>d1c3za_ a.39.2.1 (A:) Thp12-carrier protein {Yellow mealworm (Tenebrio molitor) [TaxId: 7067]}
etpreklkqhsdackaesgvseeslnkvrnreevddpklkehafcilkragfidasgefq
ldhiktkfkensehpekvddlvakcavkkdtpqhssadffkcvhdnrs

Timeline for d1c3za_:

• d1c3za_ first appeared (with stable ids) in SCOP 1.55
  
• d1c3za_ appears in SCOPe 2.05
  
• d1c3za_ appears in SCOPe 2.07
  
• d1c3za_ appears in the current release, SCOPe 2.08