Lineage for d1c3za_ (1c3z A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3515Superfamily a.39.2: Insect pheromon/odorant-binding proteins [47565] (1 family) (S)
  5. 3516Family a.39.2.1: Insect pheromon/odorant-binding proteins [47566] (2 proteins)
  6. 3521Protein Thp12-carrier protein [47567] (1 species)
  7. 3522Species Yellow mealworm (Tenebrio molitor) [TaxId:7067] [47568] (2 PDB entries)
  8. 3523Domain d1c3za_: 1c3z A: [17386]

Details for d1c3za_

PDB Entry: 1c3z (more details)

PDB Description: thp12-carrier protein from yellow meal worm

SCOP Domain Sequences for d1c3za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3za_ a.39.2.1 (A:) Thp12-carrier protein {Yellow mealworm (Tenebrio molitor)}
etpreklkqhsdackaesgvseeslnkvrnreevddpklkehafcilkragfidasgefq
ldhiktkfkensehpekvddlvakcavkkdtpqhssadffkcvhdnrs

SCOP Domain Coordinates for d1c3za_:

Click to download the PDB-style file with coordinates for d1c3za_.
(The format of our PDB-style files is described here.)

Timeline for d1c3za_: