SCOPe 2.04: Domain d1fbva1: 1fbv A:178-263

Lineage for d1fbva1 (1fbv A:178-263)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins)

6. Protein Cbl [47561] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47562] (10 PDB entries)

8. Domain d1fbva1: 1fbv A:178-263 [17384]
   Other proteins in same PDB: d1fbva2, d1fbva3, d1fbva4, d1fbvc_
   complexed with so4, zn

Details for d1fbva1

PDB Entry: 1fbv, 2.9 Å

PDB Description: structure of a cbl-ubch7 complex: ring domain function in ubiquitin- protein ligases

PDB Compounds: (A:) signal transduction protein cbl

SCOPe Domain Sequences for d1fbva1:

Sequence; same for both SEQRES and ATOM records:

>d1fbva1 a.39.1.7 (A:178-263) Cbl {Human (Homo sapiens) [TaxId: 9606]}
tfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalkstidltcndyis
vfefdiftrlfqpwssllrnwnslav

Timeline for d1fbva1:

• d1fbva1 first appeared (with stable ids) in SCOP 1.55
  
• d1fbva1 appears in SCOPe 2.03
  
• d1fbva1 appears in SCOPe 2.05
  
• d1fbva1 appears in the current release, SCOPe 2.08