SCOP 1.59: Domain d1b47a1: 1b47 A:178-263

Lineage for d1b47a1 (1b47 A:178-263)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)

4. Superfamily a.39.1: EF-hand [47473] (8 families)

5. Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (8 proteins)

6. Protein Cbl [47561] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47562] (3 PDB entries)

8. Domain d1b47a1: 1b47 A:178-263 [17381]
   Other proteins in same PDB: d1b47a2, d1b47a3, d1b47b2, d1b47b3, d1b47c2, d1b47c3

Details for d1b47a1

PDB Entry: 1b47, 2.2 Å

PDB Description: structure of the n-terminal domain of cbl in complex with its binding site in zap-70

SCOP Domain Sequences for d1b47a1:

Sequence; same for both SEQRES and ATOM records:

>d1b47a1 a.39.1.7 (A:178-263) Cbl {Human (Homo sapiens)}
tfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalkstidltcndyis
vfefdiftrlfqpwssllrnwnslav

Timeline for d1b47a1:

• d1b47a1 first appeared (with stable ids) in SCOP 1.55
  
• d1b47a1 appears in SCOP 1.57
  
• d1b47a1 appears in SCOP 1.61
  
• d1b47a1 appears in the current release, SCOPe 2.08