Lineage for d3dbjd_ (3dbj D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1979008Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1979193Protein automated matches [190531] (18 species)
    not a true protein
  7. 1979496Species Thermosynechococcus vulcanus [TaxId:32053] [188656] (1 PDB entry)
  8. 1979500Domain d3dbjd_: 3dbj D: [173801]
    automated match to d1b33b_
    complexed with cyc

Details for d3dbjd_

PDB Entry: 3dbj (more details), 2.9 Å

PDB Description: Allophycocyanin from Thermosynechococcus vulcanus
PDB Compounds: (D:) allophycocyanin

SCOPe Domain Sequences for d3dbjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dbjd_ a.1.1.3 (D:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
mqdaitavinasdvqgkyldtaameklkayfatgelrvraasvisanaanivkeavaksl
lysditrpggnmyttrryaacirdldyylryatyamlagdpsildervlnglketynslg
vpiaatvqaiqamkevtaslvgadagkemgiyfdyicsgls

SCOPe Domain Coordinates for d3dbjd_:

Click to download the PDB-style file with coordinates for d3dbjd_.
(The format of our PDB-style files is described here.)

Timeline for d3dbjd_: