SCOP 1.61: Domain d1eg4a2: 1eg4 A:210-306

Lineage for d1eg4a2 (1eg4 A:210-306)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)

4. Superfamily a.39.1: EF-hand [47473] (8 families)

5. Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (8 proteins)

6. Protein Dystrophin [47559] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47560] (2 PDB entries)

8. Domain d1eg4a2: 1eg4 A:210-306 [17379]
   Other proteins in same PDB: d1eg4a3

Details for d1eg4a2

PDB Entry: 1eg4, 2 Å

PDB Description: structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide

SCOP Domain Sequences for d1eg4a2:

Sequence; same for both SEQRES and ATOM records:

>d1eg4a2 a.39.1.7 (A:210-306) Dystrophin {Human (Homo sapiens)}
hledkyrylfkqvasstgfcdqrrlglllhdsiqiprqlgevasfggsniepsvrscfqf
annkpeieaalfldwmrlepqsmvwlpvlhrvaaaet

Timeline for d1eg4a2:

• d1eg4a2 first appeared (with stable ids) in SCOP 1.55
  
• d1eg4a2 appears in SCOP 1.59
  
• d1eg4a2 appears in SCOP 1.63
  
• d1eg4a2 appears in the current release, SCOPe 2.08