Lineage for d3da2b_ (3da2 B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 961516Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 961517Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 961518Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
  6. 961969Protein automated matches [190681] (1 species)
    not a true protein
  7. 961970Species Human (Homo sapiens) [TaxId:9606] [187805] (10 PDB entries)
  8. 961975Domain d3da2b_: 3da2 B: [173776]
    automated match to d1bzma_
    complexed with 4md, cl, zn

Details for d3da2b_

PDB Entry: 3da2 (more details), 2.05 Å

PDB Description: x-ray structure of human carbonic anhydrase 13 in complex with inhibitor
PDB Compounds: (B:) Carbonic anhydrase 13

SCOPe Domain Sequences for d3da2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3da2b_ b.74.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakiisnsg
hsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelhvvhw
nsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnfdlls
llppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaaflvs
nhrppqplkgrkvrasf

SCOPe Domain Coordinates for d3da2b_:

Click to download the PDB-style file with coordinates for d3da2b_.
(The format of our PDB-style files is described here.)

Timeline for d3da2b_: