SCOPe 2.01: Domain d3d7bb_: 3d7b B:

Lineage for d3d7bb_ (3d7b B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein automated matches [190061] (4 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186780] (69 PDB entries)

8. Domain d3d7bb_: 3d7b B: [173743]
   automated match to d1a2wa_
   complexed with flc, u4s

Details for d3d7bb_

PDB Entry: 3d7b, 1.6 Å

PDB Description: The Ribonuclease A- 5'-Deoxy-5'-N-pyrrolidinouridine complex

PDB Compounds: (B:) ribonuclease pancreatic

SCOPe Domain Sequences for d3d7bb_:

Sequence; same for both SEQRES and ATOM records:

>d3d7bb_ d.5.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d3d7bb_:

• d3d7bb_ is new in SCOPe 2.01-stable
  
• d3d7bb_ appears in SCOPe 2.02
  
• d3d7bb_ appears in the current release, SCOPe 2.08