Lineage for d1dkva1 (1dkv A:515-700)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47807Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (8 proteins)
  6. 47814Protein Calpain large subunit, C-terminal domain (domain IV) [47556] (2 species)
  7. 47815Species Human (Homo sapiens) [TaxId:9606] [47557] (1 PDB entry)
  8. 47816Domain d1dkva1: 1dkv A:515-700 [17374]
    Other proteins in same PDB: d1dkva2, d1dkva3, d1dkvb_

Details for d1dkva1

PDB Entry: 1dkv (more details), 2.7 Å

PDB Description: the crystal structure of calcium-free human m-calpain

SCOP Domain Sequences for d1dkva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dkva1 a.39.1.7 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Human (Homo sapiens)}
eieanleefdiseddiddgvrrlfaqlagedaeisafelqtilrrvlakrqdiksdgfsi
etckimvdmldsdgsgklglkefyilwtkiqkyqkiyreidvdrsgtmnsyemrkaleea
gfkmpcqlhqvivarfaddqliidfdnfvrclvrletlfkifkqldpentgtieldlisw
lcfsvl

SCOP Domain Coordinates for d1dkva1:

Click to download the PDB-style file with coordinates for d1dkva1.
(The format of our PDB-style files is described here.)

Timeline for d1dkva1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dkvb_