SCOPe 2.01: Domain d3d74b_: 3d74 B:

Lineage for d3d74b_ (3d74 B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)

6. Protein automated matches [190345] (2 species)
   not a true protein

7. Species Honeybee (Apis mellifera) [TaxId:7460] [188890] (6 PDB entries)

8. Domain d3d74b_: 3d74 B: [173734]
   automated match to d1r5ra_
   complexed with nbb; mutant

Details for d3d74b_

PDB Entry: 3d74, 2.1 Å

PDB Description: crystal structure of a pheromone binding protein mutant d35a, from apis mellifera, soaked at ph 5.5

PDB Compounds: (B:) Pheromone-binding protein ASP1

SCOPe Domain Sequences for d3d74b_:

Sequence; same for both SEQRES and ATOM records:

>d3d74b_ a.39.2.1 (B:) automated matches {Honeybee (Apis mellifera) [TaxId: 7460]}
apdwvppevfdlvaedkarcmsehgttqaqiddvakgnlvnepsitcymyclleafslvd
deanvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi

Timeline for d3d74b_:

• d3d74b_ is new in SCOPe 2.01-stable
  
• d3d74b_ appears in SCOPe 2.02
  
• d3d74b_ appears in the current release, SCOPe 2.08