Lineage for d1alwb_ (1alw B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537532Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 537533Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 538080Family a.39.1.8: Penta-EF-hand proteins [63550] (6 proteins)
  6. 538093Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)
  7. 538097Species Pig (Sus scrofa) [TaxId:9823] [47555] (6 PDB entries)
  8. 538103Domain d1alwb_: 1alw B: [17373]
    complexed with ca, isa

Details for d1alwb_

PDB Entry: 1alw (more details), 2.03 Å

PDB Description: inhibitor and calcium bound domain vi of porcine calpain

SCOP Domain Sequences for d1alwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1alwb_ a.39.1.8 (B:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa)}
eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikkwqaiykqfdvdrsgtigsselpgafeaagfhlnehlysmiir
rysdeggnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys

SCOP Domain Coordinates for d1alwb_:

Click to download the PDB-style file with coordinates for d1alwb_.
(The format of our PDB-style files is described here.)

Timeline for d1alwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1alwa_