SCOPe 2.03: Domain d3d65i_: 3d65 I:

Lineage for d3d65i_ (3d65 I:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.0: automated matches [191505] (1 protein)
   not a true family

6. Protein automated matches [190829] (3 species)
   not a true protein

7. Species Pseudonaja textilis [TaxId:169397] [188742] (3 PDB entries)

8. Domain d3d65i_: 3d65 I: [173711]
   Other proteins in same PDB: d3d65e_
   automated match to d1jc6a_
   complexed with ca

Details for d3d65i_

PDB Entry: 3d65, 1.64 Å

PDB Description: Crystal structure of Textilinin-1, a Kunitz-type serine protease inhibitor from the Australian Common Brown snake venom, in complex with trypsin

PDB Compounds: (I:) Textilinin

SCOPe Domain Sequences for d3d65i_:

Sequence; same for both SEQRES and ATOM records:

>d3d65i_ g.8.1.0 (I:) automated matches {Pseudonaja textilis [TaxId: 169397]}
rpdfcelpadtgpcrvrfpsfyynpdekkclefiyggcegnannfitkeecestca

Timeline for d3d65i_:

• d3d65i_ first appeared in SCOPe 2.01
  
• d3d65i_ appears in SCOPe 2.02
  
• d3d65i_ appears in SCOPe 2.04
  
• d3d65i_ appears in the current release, SCOPe 2.08