SCOP 1.73: Domain d1aj5b_: 1aj5 B:

Lineage for d1aj5b_ (1aj5 B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.8: Penta-EF-hand proteins [63550] (6 proteins)

6. Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47554] (6 PDB entries)

8. Domain d1aj5b_: 1aj5 B: [17368]

Details for d1aj5b_

PDB Entry: 1aj5, 2.3 Å

PDB Description: calpain domain vi apo

PDB Compounds: (B:) calpain

SCOP Domain Sequences for d1aj5b_:

Sequence; same for both SEQRES and ATOM records:

>d1aj5b_ a.39.1.8 (B:) Calpain small (regulatory) subunit (domain VI) {Rat (Rattus norvegicus) [TaxId: 10116]}
eeerqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfhlnqhiysmiir
rysdetgnmdfdnfisclvrldamfrafrsldkngtgqiqvniqewlqltmys

Timeline for d1aj5b_:

• d1aj5b_ first appeared (with stable ids) in SCOP 1.55
  
• d1aj5b_ appears in SCOP 1.71
  
• d1aj5b_ appears in SCOP 1.75
  
• d1aj5b_ appears in the current release, SCOPe 2.08