![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) ![]() |
![]() | Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
![]() | Protein automated matches [190689] (42 species) not a true protein |
![]() | Species Exiguobacterium sibiricum [TaxId:262543] [188449] (1 PDB entry) |
![]() | Domain d3d2lc_: 3d2l C: [173653] automated match to d1y8ca_ complexed with mg |
PDB Entry: 3d2l (more details), 1.9 Å
SCOPe Domain Sequences for d3d2lc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d2lc_ c.66.1.0 (C:) automated matches {Exiguobacterium sibiricum [TaxId: 262543]} mayeqfayvydelmqdvpypewvawvleqvepgkriadigcgtgtatllladhyevtgvd lseemleiaqekametnrhvdfwvqdmrelelpepvdaitilcdslnylqteadvkqtfd saarlltdggkllfdvhspykmetlfngktyathaeqssyiwfadpgeeplsvvheltff iegedgrydrvdethhqrtyppeqyitwlreagfrvcavtgdfksdaptetaeriffvae ki
Timeline for d3d2lc_: