Lineage for d3d2lb_ (3d2l B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1378488Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1378489Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1379620Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1379621Protein automated matches [190689] (42 species)
    not a true protein
  7. 1379682Species Exiguobacterium sibiricum [TaxId:262543] [188449] (1 PDB entry)
  8. 1379684Domain d3d2lb_: 3d2l B: [173652]
    automated match to d1y8ca_
    complexed with mg

Details for d3d2lb_

PDB Entry: 3d2l (more details), 1.9 Å

PDB Description: crystal structure of sam-dependent methyltransferase (zp_00538691.1) from exiguobacterium sp. 255-15 at 1.90 a resolution
PDB Compounds: (B:) SAM-dependent methyltransferase

SCOPe Domain Sequences for d3d2lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d2lb_ c.66.1.0 (B:) automated matches {Exiguobacterium sibiricum [TaxId: 262543]}
qfayvydelmqdvpypewvawvleqvepgkriadigcgtgtatllladhyevtgvdlsee
mleiaqekametnrhvdfwvqdmrelelpepvdaitilcdslnylqteadvkqtfdsaar
lltdggkllfdvhspykmetlfngktyathaeqssyiwfadpgeeplsvvheltffiege
dgrydrvdethhqrtyppeqyitwlreagfrvcavtgdfksdaptetaeriffvaeki

SCOPe Domain Coordinates for d3d2lb_:

Click to download the PDB-style file with coordinates for d3d2lb_.
(The format of our PDB-style files is described here.)

Timeline for d3d2lb_: