Lineage for d1dkvb_ (1dkv B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3181Superfamily a.39.1: EF-hand [47473] (7 families) (S)
  5. 3451Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (7 proteins)
  6. 3460Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)
  7. 3461Species Human (Homo sapiens) [TaxId:9606] [47553] (1 PDB entry)
  8. 3462Domain d1dkvb_: 1dkv B: [17364]
    Other proteins in same PDB: d1dkva1, d1dkva2, d1dkva3

Details for d1dkvb_

PDB Entry: 1dkv (more details), 2.7 Å

PDB Description: the crystal structure of calcium-free human m-calpain

SCOP Domain Sequences for d1dkvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dkvb_ a.39.1.7 (B:) Calpain small (regulatory) subunit (domain VI) {Human (Homo sapiens)}
aaasnieaneseevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtc
rsmvavmdsdttgklgfeefkylwnnikrwqaiykqfdtdrsgticsselpgafeaagfh
lnehlynmiirrysdesgnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlql
tmys

SCOP Domain Coordinates for d1dkvb_:

Click to download the PDB-style file with coordinates for d1dkvb_.
(The format of our PDB-style files is described here.)

Timeline for d1dkvb_: