SCOPe 2.08: Domain d1f4oa_: 1f4o A:

Lineage for d1f4oa_ (1f4o A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)

6. Protein Grancalcin [47550] (1 species)
   Calpain small subunit homologue

7. Species Human (Homo sapiens) [TaxId:9606] [47551] (4 PDB entries)

8. Domain d1f4oa_: 1f4o A: [17362]
   complexed with ca

Details for d1f4oa_

PDB Entry: 1f4o, 2.5 Å

PDB Description: crystal structure of grancalcin with bound calcium

PDB Compounds: (A:) grancalcin

SCOPe Domain Sequences for d1f4oa_:

Sequence; same for both SEQRES and ATOM records:

>d1f4oa_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]}
svytyfsavagqdgevdaeelqrcltqsgingtyspfsletcrimiamldrdhtgkmgfn
afkelwaalnawkenfmtvdqdgsgtvehhelrqaiglmgyrlspqtlttivkryskngr
iffddyvaccvklraltdffkkrdhlqqgsadfiyddflqgtmai

Timeline for d1f4oa_:

• d1f4oa_ first appeared (with stable ids) in SCOP 1.55
  
• d1f4oa_ appears in SCOPe 2.07