Lineage for d1f4qb_ (1f4q B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97344Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 97345Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 97667Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (8 proteins)
  6. 97708Protein Grancalcin [47550] (1 species)
  7. 97709Species Human (Homo sapiens) [TaxId:9606] [47551] (4 PDB entries)
  8. 97714Domain d1f4qb_: 1f4q B: [17361]

Details for d1f4qb_

PDB Entry: 1f4q (more details), 1.9 Å

PDB Description: crystal structure of apo grancalcin

SCOP Domain Sequences for d1f4qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4qb_ a.39.1.7 (B:) Grancalcin {Human (Homo sapiens)}
svytyfsavagqdgevdaeelqrcltqsgingtyspfsletcrimiamldrdhtgkmgfn
afkelwaalnawkenfmtvdqdgsgtvehhelrqaiglmgyrlspqtlttivkryskngr
iffddyvaccvklraltdffkkrdhlqqgsadfiyddflqgtmai

SCOP Domain Coordinates for d1f4qb_:

Click to download the PDB-style file with coordinates for d1f4qb_.
(The format of our PDB-style files is described here.)

Timeline for d1f4qb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f4qa_