Lineage for d1f4qb_ (1f4q B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (7 families) 
Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (7 proteins) 
Protein Grancalcin [47550] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47551] (2 PDB entries) 
Domain d1f4qb_: 1f4q B: [17361]
Details for d1f4qb_
PDB Entry: 1f4q (more details), 1.9 Å
PDB Description: crystal structure of apo grancalcin
SCOP Domain Sequences for d1f4qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f4qb_ a.39.1.7 (B:) Grancalcin {Human (Homo sapiens)}
svytyfsavagqdgevdaeelqrcltqsgingtyspfsletcrimiamldrdhtgkmgfn
afkelwaalnawkenfmtvdqdgsgtvehhelrqaiglmgyrlspqtlttivkryskngr
iffddyvaccvklraltdffkkrdhlqqgsadfiyddflqgtmai
SCOP Domain Coordinates for d1f4qb_:
Click to download the PDB-style file with coordinates for d1f4qb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f4qb_:
- d1f4qb_ appears in SCOP 1.57
- d1f4qb_ appears in the current release, SCOPe 2.08
View in 3D
