Lineage for d1f4qa_ (1f4q A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711466Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)
  6. 2711527Protein Grancalcin [47550] (1 species)
    Calpain small subunit homologue
  7. 2711528Species Human (Homo sapiens) [TaxId:9606] [47551] (4 PDB entries)
  8. 2711531Domain d1f4qa_: 1f4q A: [17360]

Details for d1f4qa_

PDB Entry: 1f4q (more details), 1.9 Å

PDB Description: crystal structure of apo grancalcin
PDB Compounds: (A:) grancalcin

SCOPe Domain Sequences for d1f4qa_:

Sequence, based on SEQRES records: (download)

>d1f4qa_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]}
svytyfsavagqdgevdaeelqrcltqsgingtyspfsletcrimiamldrdhtgkmgfn
afkelwaalnawkenfmtvdqdgsgtvehhelrqaiglmgyrlspqtlttivkryskngr
iffddyvaccvklraltdffkkrdhlqqgsadfiyddflqgtmai

Sequence, based on observed residues (ATOM records): (download)

>d1f4qa_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]}
svytyfsavagqdgevdaeelqrcltqsgingtyspfsletcrimiamldrdhtgkmgfn
afkelwaalnawkenfmtvdgtvehhelrqaiglmgyrlspqtlttivkryskngriffd
dyvaccvklraltdffkkrdhlqqgsadfiyddflqgtmai

SCOPe Domain Coordinates for d1f4qa_:

Click to download the PDB-style file with coordinates for d1f4qa_.
(The format of our PDB-style files is described here.)

Timeline for d1f4qa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f4qb_