SCOPe 2.06: Domain d3cztx_: 3czt X:

Lineage for d3cztx_ (3czt X:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Human (Homo sapiens), s100b [TaxId:9606] [47483] (11 PDB entries)

8. Domain d3cztx_: 3czt X: [173564]
   automated match to d1mq1a_
   complexed with ca, zn

Details for d3cztx_

PDB Entry: 3czt, 1.4 Å

PDB Description: crystal structure of s100b in the calcium and zinc loaded state at ph 9

PDB Compounds: (X:) Protein S100-B

SCOPe Domain Sequences for d3cztx_:

Sequence; same for both SEQRES and ATOM records:

>d3cztx_ a.39.1.2 (X:) Calcyclin (S100) {Human (Homo sapiens), s100b [TaxId: 9606]}
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldndgdgecdfqefmafvamvttacheffeh

Timeline for d3cztx_:

• d3cztx_ first appeared in SCOPe 2.01
  
• d3cztx_ appears in SCOPe 2.05
  
• d3cztx_ appears in SCOPe 2.07
  
• d3cztx_ appears in the current release, SCOPe 2.08