Lineage for d3cywa_ (3cyw A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2799131Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2799147Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2799397Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (590 PDB entries)
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. 2799528Domain d3cywa_: 3cyw A: [173548]
    automated match to d1fgcc_
    complexed with 017, cl, gol; mutant

Details for d3cywa_

PDB Entry: 3cyw (more details), 1.4 Å

PDB Description: effect of flap mutations on structure of hiv-1 protease and inhibition by saquinavir and darunavir
PDB Compounds: (A:) hiv-1 protease

SCOPe Domain Sequences for d3cywa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cywa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmivgiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

SCOPe Domain Coordinates for d3cywa_:

Click to download the PDB-style file with coordinates for d3cywa_.
(The format of our PDB-style files is described here.)

Timeline for d3cywa_: