Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) contains a long alpha helical insertion in the interdomain linker |
Family c.92.2.0: automated matches [191548] (1 protein) not a true family |
Protein automated matches [190944] (28 species) not a true protein |
Species Streptococcus pneumoniae [TaxId:171101] [188513] (1 PDB entry) |
Domain d3cx3b_: 3cx3 B: [173522] automated match to d1xvla1 complexed with na, zn |
PDB Entry: 3cx3 (more details), 2.4 Å
SCOPe Domain Sequences for d3cx3b_:
Sequence, based on SEQRES records: (download)
>d3cx3b_ c.92.2.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 171101]} kgmkivtsfypiyamvkevsgdlndvrmiqsssgihsfepsandiaaiydadvfvyhsht leswagsldpnlkkskvkvleasegmtlervpgledveagdgvdektlydphtwldpeka geeaqiiadklsevdsehketyqknaqafikkaqeltkkfqpkfekatqktfvtqhtafs ylakrfglnqlgiagispeqepsprqlteiqefvktykvktiftesnasskvaetlvkst gvglktlnplesdpqndktylenleenmsilaeelk
>d3cx3b_ c.92.2.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 171101]} kgmkivtsfypiyamvkevsgdlndvrmiqsssgihsfepsandiaaiydadvfvyhsht leswagsldpnlkkskvkvleasegmtlervpgtlydphtwldpekageeaqiiadklse vdsehketyqknaqafikkaqeltkkfqpkfekatqktfvtqhtafsylakrfglnqlgi agispeqepsprqlteiqefvktykvktiftesnasvaetlvkstgvglktlnplesdpn dktylenleenmsilaeelk
Timeline for d3cx3b_: