Class a: All alpha proteins [46456] (290 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (99 species) not a true protein |
Species Streptomyces griseolus [TaxId:1909] [188416] (6 PDB entries) |
Domain d3cv9a1: 3cv9 A:8-406 [173493] Other proteins in same PDB: d3cv9a2 automated match to d1cl6a_ complexed with hem, vdx; mutant |
PDB Entry: 3cv9 (more details), 1.7 Å
SCOPe Domain Sequences for d3cv9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cv9a1 a.104.1.0 (A:8-406) automated matches {Streptomyces griseolus [TaxId: 1909]} pqttdapafpsnrscpyqlpdgyaqlrdtpgplhrvtlydgrqawvvtkheaarkllgdp rlssnatddnfpatspafeavrespqafigldppehgtrrrmtiseftvkrikgmrpeve evvhgfldemlaagptadlvsqfalpvpsmvicrllgvpyadheffqdaskrlvqstdaq saltarndlagyldglitqfqtepgaglvgalvadqlangeidreelistamllliaghe ttasmtslsvitlldhpeqyaalradrslvpgaveellrylaiadiaggrvatadieveg qliragegvivvnsianrdgtvyedpdaldihrsarhhlafgfgvhqclgqnlarlelev ilnalmdrvptlrlavpveqlvlrpgttiqgvnelpvtw
Timeline for d3cv9a1: