Lineage for d3curc_ (3cur C:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3019032Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 3019033Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 3019034Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)
  6. 3019069Protein automated matches [190110] (7 species)
    not a true protein
  7. 3019109Species Desulfovibrio fructosovorans [TaxId:878] [188149] (12 PDB entries)
  8. 3019121Domain d3curc_: 3cur C: [173474]
    Other proteins in same PDB: d3curh_, d3curi_, d3curj_
    automated match to d1frfs_
    complexed with f3s, fco, gol, mg, ni, per, sf4; mutant

Details for d3curc_

PDB Entry: 3cur (more details), 2.4 Å

PDB Description: Structure of a double methionine mutant of NI-FE hydrogenase
PDB Compounds: (C:) Periplasmic [NiFe] hydrogenase Small subunit

SCOPe Domain Sequences for d3curc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3curc_ e.19.1.1 (C:) automated matches {Desulfovibrio fructosovorans [TaxId: 878]}
hrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalhqal
egkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqkak
pnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfygelvh
dncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqaghp
clgcsepdfwdtmtpfyeqg

SCOPe Domain Coordinates for d3curc_:

Click to download the PDB-style file with coordinates for d3curc_.
(The format of our PDB-style files is described here.)

Timeline for d3curc_: